Lineage for d1j0ia3 (1j0i A:124-505)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830302Protein Neopullulanase, central domain [82240] (1 species)
    homologous to Maltogenic amylase
  7. 2830303Species Bacillus stearothermophilus [TaxId:1422] [82241] (4 PDB entries)
  8. 2830306Domain d1j0ia3: 1j0i A:124-505 [77035]
    Other proteins in same PDB: d1j0ia1, d1j0ia2, d1j0ib1, d1j0ib2

Details for d1j0ia3

PDB Entry: 1j0i (more details), 2.4 Å

PDB Description: crystal structure of neopullulanase complex with panose
PDB Compounds: (A:) neopullulanase

SCOPe Domain Sequences for d1j0ia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0ia3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]}
dlfeapdwvkdtvwyqifperfangnpsispegsrpwgsedptptsffggdlqgiidhld
ylvdlgitgiyltpifrspsnhkydtadyfevdphfgdketlktlidrchekgirvmlda
vfnhcgyefapfqdvwkngesskykdwfhihefplqteprpnydtfafvpqmpklntanp
evkrylldvatywirefdidgwrldvaneidhefwrefrqevkalkpdvyilgeiwhdam
pwlrgdqfdavmnypftdgvlrffakeeisarqfanqmmhvlhsypnnvneaafnllgsh
dtsriltvcggdirkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpmqqn
kelhqhvkqlialrkqyrslrr

SCOPe Domain Coordinates for d1j0ia3:

Click to download the PDB-style file with coordinates for d1j0ia3.
(The format of our PDB-style files is described here.)

Timeline for d1j0ia3: