Lineage for d1j07a_ (1j07 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 248565Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 248566Superfamily c.69.1: alpha/beta-Hydrolases [53474] (26 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 248567Family c.69.1.1: Acetylcholinesterase-like [53475] (4 proteins)
  6. 248568Protein Acetylcholinesterase [53476] (5 species)
  7. 248621Species Mouse (Mus musculus) [TaxId:10090] [53479] (6 PDB entries)
  8. 248626Domain d1j07a_: 1j07 A: [77023]

Details for d1j07a_

PDB Entry: 1j07 (more details), 2.35 Å

PDB Description: crystal structure of the mouse acetylcholinesterase-decidium complex

SCOP Domain Sequences for d1j07a_:

Sequence, based on SEQRES records: (download)

>d1j07a_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus)}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfv
pvvdgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqfl
agvrigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaa
qgarvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkyw
tnfartgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll
sa

Sequence, based on observed residues (ATOM records): (download)

>d1j07a_ c.69.1.1 (A:) Acetylcholinesterase {Mouse (Mus musculus)}
egredpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvl
dattfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiyg
ggfysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlal
qwvqeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvs
agearrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgd
flsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrig
vpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvy
ayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfart
gdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsa

SCOP Domain Coordinates for d1j07a_:

Click to download the PDB-style file with coordinates for d1j07a_.
(The format of our PDB-style files is described here.)

Timeline for d1j07a_: