Lineage for d1izlv_ (1izl V:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 754704Fold i.5: Photosystems [58155] (1 superfamily)
  4. 754705Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 754706Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 754720Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 754758Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 754796Domain d1izlv_: 1izl V: [77015]

Details for d1izlv_

PDB Entry: 1izl (more details), 3.7 Å

PDB Description: crystal structure of photosystem ii
PDB Compounds: (V:) photosystem II: subunit psbv

SCOP Domain Sequences for d1izlv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izlv_ i.5.1.1 (V:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
eltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetlal
atpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghilv
epkilgdkw

SCOP Domain Coordinates for d1izlv_:

Click to download the PDB-style file with coordinates for d1izlv_.
(The format of our PDB-style files is described here.)

Timeline for d1izlv_: