Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) |
Protein Malate dehydrogenase [56329] (11 species) |
Species Thermus thermophilus [TaxId:274] [82806] (1 PDB entry) identical sequence to that from the Thermus flavus enzyme |
Domain d1iz9b2: 1iz9 B:155-327 [76987] Other proteins in same PDB: d1iz9a1, d1iz9b1 |
PDB Entry: 1iz9 (more details), 2 Å
SCOP Domain Sequences for d1iz9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iz9b2 d.162.1.1 (B:155-327) Malate dehydrogenase {Thermus thermophilus} mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli
Timeline for d1iz9b2: