Lineage for d1ixsb2 (1ixs B:4-242)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1849193Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1849319Protein Holliday junction helicase RuvB [52713] (2 species)
    contains "winged helix" DNA-binding domain after the family specific domains
  7. 1849327Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries)
  8. 1849328Domain d1ixsb2: 1ixs B:4-242 [76934]
    Other proteins in same PDB: d1ixsa_, d1ixsb1
    complexed with anp

Details for d1ixsb2

PDB Entry: 1ixs (more details), 3.2 Å

PDB Description: Structure of RuvB complexed with RuvA domain III
PDB Compounds: (B:) ruvb

SCOPe Domain Sequences for d1ixsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}
lalrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelg
vnlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivi
gqgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarl
lgvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde

SCOPe Domain Coordinates for d1ixsb2:

Click to download the PDB-style file with coordinates for d1ixsb2.
(The format of our PDB-style files is described here.)

Timeline for d1ixsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ixsb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ixsa_