Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (28 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Holliday junction helicase RuvB [52713] (2 species) contains "winged helix" DNA-binding domain after the family specific domains |
Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries) |
Domain d1ixrc2: 1ixr C:5-242 [76931] Other proteins in same PDB: d1ixra1, d1ixra2, d1ixrb1, d1ixrb2, d1ixrb3, d1ixrc1 complexed with anp; mutant |
PDB Entry: 1ixr (more details), 3.3 Å
SCOP Domain Sequences for d1ixrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixrc2 c.37.1.20 (C:5-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde
Timeline for d1ixrc2: