Lineage for d1ixrc2 (1ixr C:5-242)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 244141Family c.37.1.20: Extended AAA-ATPase domain [81269] (14 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 244186Protein Holliday junction helicase RuvB [52713] (2 species)
    contains "winged helix" DNA-binding domain after the family specific domains
  7. 244194Species Thermus thermophilus [TaxId:274] [52714] (3 PDB entries)
  8. 244198Domain d1ixrc2: 1ixr C:5-242 [76931]
    Other proteins in same PDB: d1ixra1, d1ixra2, d1ixrb1, d1ixrb2, d1ixrb3, d1ixrc1
    complexed with anp; mutant

Details for d1ixrc2

PDB Entry: 1ixr (more details), 3.3 Å

PDB Description: ruva-ruvb complex

SCOP Domain Sequences for d1ixrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixrc2 c.37.1.20 (C:5-242) Holliday junction helicase RuvB {Thermus thermophilus}
alrpktldeyigqerlkqklrvyleaakarkeplehlllfgppglgkttlahviahelgv
nlrvtsgpaiekpgdlaailansleegdilfideihrlsrqaeehlypamedfvmdivig
qgpaartirlelprftligattrpglitapllsrfgivehleyytpeelaqgvmrdarll
gvriteeaaleigrrsrgtmrvakrlfrrvrdfaqvageevitreralealaalglde

SCOP Domain Coordinates for d1ixrc2:

Click to download the PDB-style file with coordinates for d1ixrc2.
(The format of our PDB-style files is described here.)

Timeline for d1ixrc2: