Lineage for d1ixrb3 (1ixr B:1-62)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229143Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
  6. 229144Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 229164Species Thermus thermophilus [TaxId:274] [82098] (1 PDB entry)
  8. 229166Domain d1ixrb3: 1ixr B:1-62 [76929]
    Other proteins in same PDB: d1ixra1, d1ixrb1, d1ixrb2, d1ixrc1, d1ixrc2
    complexed with anp; mutant

Details for d1ixrb3

PDB Entry: 1ixr (more details), 3.3 Å

PDB Description: ruva-ruvb complex

SCOP Domain Sequences for d1ixrb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixrb3 b.40.4.2 (B:1-62) DNA helicase RuvA subunit, N-terminal domain {Thermus thermophilus}
mirylrglvlkkeaggfvllaggvgfflqaptpflqaleegkevgvhthlllkeeglsly
gf

SCOP Domain Coordinates for d1ixrb3:

Click to download the PDB-style file with coordinates for d1ixrb3.
(The format of our PDB-style files is described here.)

Timeline for d1ixrb3: