Class a: All alpha proteins [46456] (179 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) possibly related to UBA-like domains |
Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein) |
Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species) tetramer; binds Holliday junction |
Species Thermus thermophilus [TaxId:274] [81702] (2 PDB entries) |
Domain d1ixrb1: 1ixr B:139-191 [76927] Other proteins in same PDB: d1ixra1, d1ixra2, d1ixrb2, d1ixrb3, d1ixrc1, d1ixrc2 complexed with anp; mutant |
PDB Entry: 1ixr (more details), 3.3 Å
SCOP Domain Sequences for d1ixrb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ixrb1 a.5.1.1 (B:139-191) DNA helicase RuvA subunit, C-terminal domain {Thermus thermophilus} ekveseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr
Timeline for d1ixrb1:
View in 3D Domains from other chains: (mouse over for more information) d1ixra1, d1ixra2, d1ixrc1, d1ixrc2 |