Lineage for d1ixrb1 (1ixr B:139-191)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 278490Fold a.5: RuvA C-terminal domain-like [46928] (6 superfamilies)
    3 helices; bundle, right-handed twist
  4. 278491Superfamily a.5.1: DNA helicase RuvA subunit, C-terminal domain [46929] (1 family) (S)
    possibly related to UBA-like domains
  5. 278492Family a.5.1.1: DNA helicase RuvA subunit, C-terminal domain [46930] (1 protein)
  6. 278493Protein DNA helicase RuvA subunit, C-terminal domain [46931] (3 species)
    tetramer; binds Holliday junction
  7. 278511Species Thermus thermophilus [TaxId:274] [81702] (2 PDB entries)
  8. 278513Domain d1ixrb1: 1ixr B:139-191 [76927]
    Other proteins in same PDB: d1ixra1, d1ixra2, d1ixrb2, d1ixrb3, d1ixrc1, d1ixrc2
    complexed with anp; mutant

Details for d1ixrb1

PDB Entry: 1ixr (more details), 3.3 Å

PDB Description: ruva-ruvb complex

SCOP Domain Sequences for d1ixrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ixrb1 a.5.1.1 (B:139-191) DNA helicase RuvA subunit, C-terminal domain {Thermus thermophilus}
ekveseaaeeavmalaalgfkeaqaravvldllaqnpkaraqdlikealkrlr

SCOP Domain Coordinates for d1ixrb1:

Click to download the PDB-style file with coordinates for d1ixrb1.
(The format of our PDB-style files is described here.)

Timeline for d1ixrb1: