SCOPe 2.05: Domain d1ixra2: 1ixr A:1-62

Lineage for d1ixra2 (1ixr A:1-62)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
   barrel, closed; n=5, S=10
   automatically mapped to Pfam PF01330

6. Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
   tetramer; binds Holliday junction

7. Species Thermus thermophilus [TaxId:274] [82098] (1 PDB entry)

8. Domain d1ixra2: 1ixr A:1-62 [76926]
   Other proteins in same PDB: d1ixra1, d1ixrb1, d1ixrb2, d1ixrc1, d1ixrc2
   complexed with anp

Details for d1ixra2

PDB Entry: 1ixr, 3.3 Å

PDB Description: ruva-ruvb complex

PDB Compounds: (A:) holliday junction DNA helicase ruva

SCOPe Domain Sequences for d1ixra2:

Sequence; same for both SEQRES and ATOM records:

>d1ixra2 b.40.4.2 (A:1-62) DNA helicase RuvA subunit, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mirylrglvlkkeaggfvllaggvgfflqaptpflqaleegkevgvhthlllkeeglsly
gf

Timeline for d1ixra2:

• d1ixra2 first appeared in SCOP 1.63
  
• d1ixra2 appears in SCOPe 2.04
  
• d1ixra2 appears in SCOPe 2.06
  
• d1ixra2 appears in the current release, SCOPe 2.08