Class a: All alpha proteins [46456] (284 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) |
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins) |
Protein Mn superoxide dismutase (MnSOD) [46618] (7 species) |
Species Escherichia coli [TaxId:562] [46620] (11 PDB entries) |
Domain d1ix9b1: 1ix9 B:1-90 [76901] Other proteins in same PDB: d1ix9a2, d1ix9b2 complexed with mh3; mutant |
PDB Entry: 1ix9 (more details), 0.9 Å
SCOP Domain Sequences for d1ix9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ix9b1 a.2.11.1 (B:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]} sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl dqlpadkktvlrnnagghanhslfwkglkk
Timeline for d1ix9b1: