Lineage for d1ix9b1 (1ix9 B:1-90)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760309Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 760310Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 760436Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 760454Species Escherichia coli [TaxId:562] [46620] (11 PDB entries)
  8. 760456Domain d1ix9b1: 1ix9 B:1-90 [76901]
    Other proteins in same PDB: d1ix9a2, d1ix9b2
    complexed with mh3; mutant

Details for d1ix9b1

PDB Entry: 1ix9 (more details), 0.9 Å

PDB Description: crystal structure of the e. coli manganase(iii) superoxide dismutase mutant y174f at 0.90 angstroms resolution.
PDB Compounds: (B:) superoxide dismutase

SCOP Domain Sequences for d1ix9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ix9b1 a.2.11.1 (B:1-90) Mn superoxide dismutase (MnSOD) {Escherichia coli [TaxId: 562]}
sytlpslpyaydalephfdkqtmeihhtkhhqtyvnnanaaleslpefanlpveelitkl
dqlpadkktvlrnnagghanhslfwkglkk

SCOP Domain Coordinates for d1ix9b1:

Click to download the PDB-style file with coordinates for d1ix9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ix9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ix9b2