![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein) |
![]() | Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [81972] (2 PDB entries) |
![]() | Domain d1ix2b_: 1ix2 B: [76898] complexed with mse |
PDB Entry: 1ix2 (more details), 1.55 Å
SCOP Domain Sequences for d1ix2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ix2b_ b.1.18.17 (B:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]} hpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakvap gadpksmviipreplpagtyrvdwravssdthpitgnytftvk
Timeline for d1ix2b_: