SCOPe 2.08: Domain d1ix2b_: 1ix2 B:

Lineage for d1ix2b_ (1ix2 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
   automatically mapped to Pfam PF04234
   automatically mapped to Pfam PF13205

6. Protein Copper resistance protein C (CopC, PcoC) [81970] (3 species)

7. Species Escherichia coli [TaxId:562] [81972] (2 PDB entries)

8. Domain d1ix2b_: 1ix2 B: [76898]

Details for d1ix2b_

PDB Entry: 1ix2, 1.55 Å

PDB Description: Crystal Structure of Selenomethionine PcoC, a Copper Resistance Protein from Escherichia coli

PDB Compounds: (B:) PcoC copper resistance protein

SCOPe Domain Sequences for d1ix2b_:

Sequence; same for both SEQRES and ATOM records:

>d1ix2b_ b.1.18.17 (B:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]}
hpelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakvap
gadpksmviipreplpagtyrvdwravssdthpitgnytftvk

Timeline for d1ix2b_:

• d1ix2b_ first appeared in SCOP 1.63
  
• d1ix2b_ appears in SCOPe 2.07