Lineage for d1ix2a_ (1ix2 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789632Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein)
  6. 789633Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species)
  7. 789634Species Escherichia coli [TaxId:562] [81972] (2 PDB entries)
  8. 789635Domain d1ix2a_: 1ix2 A: [76897]

Details for d1ix2a_

PDB Entry: 1ix2 (more details), 1.55 Å

PDB Description: Crystal Structure of Selenomethionine PcoC, a Copper Resistance Protein from Escherichia coli
PDB Compounds: (A:) PcoC copper resistance protein

SCOP Domain Sequences for d1ix2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ix2a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Escherichia coli [TaxId: 562]}
pelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakvapg
adpksmviipreplpagtyrvdwravssdthpitgnytftvk

SCOP Domain Coordinates for d1ix2a_:

Click to download the PDB-style file with coordinates for d1ix2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ix2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ix2b_