Lineage for d1ix2a_ (1ix2 A:)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.18: E set domains [81296] (17 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.17: Copper resistance protein C (CopC, PcoC) [81969] (1 protein) Protein Copper resistance protein C (CopC, PcoC) [81970] (2 species) Species Escherichia coli [TaxId:562] [81972] (2 PDB entries) 
Domain d1ix2a_: 1ix2 A: [76897]
Details for d1ix2a_
PDB Entry: 1ix2 (more details), 1.55 Å
PDB Description: Crystal Structure of Selenomethionine PcoC, a Copper Resistance Protein from Escherichia coli
SCOP Domain Sequences for d1ix2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ix2a_ b.1.18.17 (A:) Copper resistance protein C (CopC, PcoC) {Escherichia coli}
pelkssvpqadsavaapekiqlnfsenltvkfsgakltmtgmkgmsshspmpvaakvapg
adpksmviipreplpagtyrvdwravssdthpitgnytftvk
SCOP Domain Coordinates for d1ix2a_:
Click to download the PDB-style file with coordinates for d1ix2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ix2a_:
- d1ix2a_ is new in SCOP 1.63
- d1ix2a_ appears in SCOP 1.65
- d1ix2a_ appears in the current release, SCOPe 2.08
View in 3D
