Lineage for d1iw5a_ (1iw5 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328444Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 328516Superfamily d.52.6: BolA-like [82657] (1 family) (S)
  5. 328517Family d.52.6.1: BolA-like [82658] (1 protein)
  6. 328518Protein BolA-like protein [82659] (1 species)
  7. 328519Species Mouse (Mus musculus) [TaxId:10090] [82660] (1 PDB entry)
  8. 328520Domain d1iw5a_: 1iw5 A: [76864]
    structural genomics

Details for d1iw5a_

PDB Entry: 1iw5 (more details)

PDB Description: Solution structure of the BolA-like protein from Mus musculus

SCOP Domain Sequences for d1iw5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iw5a_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus)}
mkgsshhhhhhssgaslvprgsegaatmelsadylreklrqdleaehvevedttlnrcat
sfrvlvvsakfegkpllqrhrlvneclaeelphihafeqktltpeqwtrqrre

SCOP Domain Coordinates for d1iw5a_:

Click to download the PDB-style file with coordinates for d1iw5a_.
(The format of our PDB-style files is described here.)

Timeline for d1iw5a_: