SCOPe 2.06: Domain d1ivza1: 1ivz A:8-126

Lineage for d1ivza1 (1ivz A:8-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.41: SEA domain [82671] (1 family)
   automatically mapped to Pfam PF01390

5. Family d.58.41.1: SEA domain [82672] (1 protein)

6. Protein SEA domain from the hypothetical protein homologous to mucin 16 [82673] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82674] (1 PDB entry)

8. Domain d1ivza1: 1ivz A:8-126 [76863]
   Other proteins in same PDB: d1ivza2, d1ivza3
   structural genomics

Details for d1ivza1

PDB Entry: 1ivz

PDB Description: solution structure of the sea domain from murine hypothetical protein homologous to human mucin 16

PDB Compounds: (A:) hypothetical protein 1110008I14RIK

SCOPe Domain Sequences for d1ivza1:

Sequence; same for both SEQRES and ATOM records:

>d1ivza1 d.58.41.1 (A:8-126) SEA domain from the hypothetical protein homologous to mucin 16 {Mouse (Mus musculus) [TaxId: 10090]}
ssssqhfnlnftitnlpysqdiaqpsttkyqqtkrsienalnqlfrnssiksyfsdcqvl
afrsvsnnnnhtgvdslcnfsplarrvdrvaiyeeflrmthngtqllnftldrksvfvd

Timeline for d1ivza1:

• d1ivza1 first appeared in SCOP 1.63, called d1ivza_
  
• d1ivza1 was called d1ivza_ in SCOPe 2.05
  
• d1ivza1 appears in SCOPe 2.07
  
• d1ivza1 appears in the current release, SCOPe 2.08