Lineage for d1ivob3 (1ivo B:163-311)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582446Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2582447Family g.3.9.1: Growth factor receptor domain [57185] (10 proteins)
    Pfam PF00757; Pfam PF14843; Pfam PF15913
  6. 2582448Protein EGF receptor Cys-rich domains [82887] (1 species)
  7. 2582449Species Human (Homo sapiens) [TaxId:9606] [82888] (6 PDB entries)
  8. 2582461Domain d1ivob3: 1ivo B:163-311 [76851]
    Other proteins in same PDB: d1ivoa1, d1ivoa2, d1ivoa5, d1ivob1, d1ivob2, d1ivob5, d1ivoc_, d1ivod_
    complexed with EGF
    complexed with nag

Details for d1ivob3

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: Crystal Structure of the Complex of Human Epidermal Growth Factor and Receptor Extracellular Domains.
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1ivob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivob3 g.3.9.1 (B:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]}
cqkcdpscpngscwgageencqkltkiicaqqcsgrcrgkspsdcchnqcaagctgpres
dclvcrkfrdeatckdtcpplmlynpttyqmdvnpegkysfgatcvkkcprnyvvtdhgs
cvracgadsyemeedgvrkckkcegpcrk

SCOPe Domain Coordinates for d1ivob3:

Click to download the PDB-style file with coordinates for d1ivob3.
(The format of our PDB-style files is described here.)

Timeline for d1ivob3: