Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N |
Superfamily c.10.2: L domain-like [52058] (7 families) less regular structure consisting of variable repeats |
Family c.10.2.5: L domain [52071] (4 proteins) this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain |
Protein EGF receptor extracellular domain [82326] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82327] (1 PDB entry) |
Domain d1ivob2: 1ivo B:312-480 [76850] Other proteins in same PDB: d1ivoa3, d1ivoa4, d1ivob3, d1ivob4, d1ivoc_, d1ivod_ L1 and L2 domains complexed with nag |
PDB Entry: 1ivo (more details), 3.3 Å
SCOP Domain Sequences for d1ivob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivob2 c.10.2.5 (B:312-480) EGF receptor extracellular domain {Human (Homo sapiens)} vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
Timeline for d1ivob2: