Lineage for d1ivob2 (1ivo B:312-480)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240418Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N
  4. 240457Superfamily c.10.2: L domain-like [52058] (7 families) (S)
    less regular structure consisting of variable repeats
  5. 240500Family c.10.2.5: L domain [52071] (4 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 240501Protein EGF receptor extracellular domain [82326] (1 species)
  7. 240502Species Human (Homo sapiens) [TaxId:9606] [82327] (1 PDB entry)
  8. 240506Domain d1ivob2: 1ivo B:312-480 [76850]
    Other proteins in same PDB: d1ivoa3, d1ivoa4, d1ivob3, d1ivob4, d1ivoc_, d1ivod_
    L1 and L2 domains
    complexed with nag

Details for d1ivob2

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.

SCOP Domain Sequences for d1ivob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivob2 c.10.2.5 (B:312-480) EGF receptor extracellular domain {Human (Homo sapiens)}
vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil
ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke
isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq

SCOP Domain Coordinates for d1ivob2:

Click to download the PDB-style file with coordinates for d1ivob2.
(The format of our PDB-style files is described here.)

Timeline for d1ivob2: