Lineage for d1ivob1 (1ivo B:6-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459922Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2459991Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2460079Family c.10.2.5: L domain [52071] (6 proteins)
    this is a repeat family; one repeat unit is 1n8z C:42-66 found in domain
  6. 2460080Protein EGF receptor extracellular domain [82326] (1 species)
  7. 2460081Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries)
  8. 2460101Domain d1ivob1: 1ivo B:6-162 [76849]
    Other proteins in same PDB: d1ivoa3, d1ivoa4, d1ivoa5, d1ivob3, d1ivob4, d1ivob5, d1ivoc_, d1ivod_
    L1 and L2 domains; complexed with EGF
    complexed with nag

Details for d1ivob1

PDB Entry: 1ivo (more details), 3.3 Å

PDB Description: crystal structure of the complex of human epidermal growth factor and receptor extracellular domains.
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d1ivob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivob1 c.10.2.5 (B:6-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vcqgtsnkltqlgtfedhflslqrmfnncevvlgnleityvqrnydlsflktiqevagyv
lialntveriplenlqiirgnmyyensyalavlsnydanktglkelpmrnlqeilhgavr
fsnnpalcnvesiqwrdivssdflsnmsmdfqnhlgs

SCOPe Domain Coordinates for d1ivob1:

Click to download the PDB-style file with coordinates for d1ivob1.
(The format of our PDB-style files is described here.)

Timeline for d1ivob1: