![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.5: L domain [52071] (6 proteins) |
![]() | Protein EGF receptor extracellular domain [82326] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82327] (7 PDB entries) |
![]() | Domain d1ivoa2: 1ivo A:312-480 [76846] Other proteins in same PDB: d1ivoa3, d1ivoa4, d1ivoa5, d1ivob3, d1ivob4, d1ivob5, d1ivoc_, d1ivod_ L1 and L2 domains; complexed with EGF complexed with nag |
PDB Entry: 1ivo (more details), 3.3 Å
SCOPe Domain Sequences for d1ivoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivoa2 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} vcngigigefkdslsinatnikhfknctsisgdlhilpvafrgdsfthtppldpqeldil ktvkeitgflliqawpenrtdlhafenleiirgrtkqhgqfslavvslnitslglrslke isdgdviisgnknlcyantinwkklfgtsgqktkiisnrgensckatgq
Timeline for d1ivoa2: