Lineage for d1iv8a1 (1iv8 A:654-720)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810663Protein Maltooligosyl trehalose synthase [82177] (1 species)
  7. 2810664Species Sulfolobus acidocaldarius [TaxId:2285] [82178] (1 PDB entry)
  8. 2810665Domain d1iv8a1: 1iv8 A:654-720 [76842]
    Other proteins in same PDB: d1iv8a2

Details for d1iv8a1

PDB Entry: 1iv8 (more details), 1.9 Å

PDB Description: Crystal Structure of Maltooligosyl trehalose synthase
PDB Compounds: (A:) maltooligosyl trehalose synthase

SCOPe Domain Sequences for d1iv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iv8a1 b.71.1.1 (A:654-720) Maltooligosyl trehalose synthase {Sulfolobus acidocaldarius [TaxId: 2285]}
eykgldleeglcgfirfnkilviiktkgsvnyklkleegaiytdvltgeeikkevqinel
prilvrm

SCOPe Domain Coordinates for d1iv8a1:

Click to download the PDB-style file with coordinates for d1iv8a1.
(The format of our PDB-style files is described here.)

Timeline for d1iv8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iv8a2