Lineage for d1itzc3 (1itz C:540-675)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245392Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 245393Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 245394Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 245399Protein Transketolase (TK), C-domain [52924] (2 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 245415Species Maize (Zea mays) [TaxId:4577] [82430] (1 PDB entry)
  8. 245418Domain d1itzc3: 1itz C:540-675 [76805]
    Other proteins in same PDB: d1itza1, d1itza2, d1itzb1, d1itzb2, d1itzc1, d1itzc2
    complexed with mg, tpp

Details for d1itzc3

PDB Entry: 1itz (more details), 2.3 Å

PDB Description: Maize Transketolase in complex with TPP

SCOP Domain Sequences for d1itzc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itzc3 c.48.1.1 (C:540-675) Transketolase (TK), C-domain {Maize (Zea mays)}
pgtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvsw
elfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyk
eygitvesiiaaaksf

SCOP Domain Coordinates for d1itzc3:

Click to download the PDB-style file with coordinates for d1itzc3.
(The format of our PDB-style files is described here.)

Timeline for d1itzc3: