Lineage for d1itzc2 (1itz C:348-539)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162531Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 1162550Protein Transketolase (TK), Pyr module [88736] (4 species)
  7. 1162578Species Maize (Zea mays) [TaxId:4577] [88738] (1 PDB entry)
  8. 1162581Domain d1itzc2: 1itz C:348-539 [76804]
    Other proteins in same PDB: d1itza1, d1itza3, d1itzb1, d1itzb3, d1itzc1, d1itzc3
    complexed with mg, tpp

Details for d1itzc2

PDB Entry: 1itz (more details), 2.3 Å

PDB Description: Maize Transketolase in complex with TPP
PDB Compounds: (C:) transketolase

SCOPe Domain Sequences for d1itzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itzc2 c.36.1.6 (C:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]}
lptgwvdalpkytpespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdf
qkdtaeernvrfgvrehgmgaicngialhspgfvpycatffvftdymrgamrisalseag
viyvmthdsiglgedgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrps
ilalsrqklphl

SCOPe Domain Coordinates for d1itzc2:

Click to download the PDB-style file with coordinates for d1itzc2.
(The format of our PDB-style files is described here.)

Timeline for d1itzc2: