Lineage for d1itzb3 (1itz B:540-675)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 834846Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 834847Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 834848Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 834867Protein Transketolase (TK), C-domain [52924] (4 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 834895Species Maize (Zea mays) [TaxId:4577] [82430] (1 PDB entry)
  8. 834897Domain d1itzb3: 1itz B:540-675 [76802]
    Other proteins in same PDB: d1itza1, d1itza2, d1itzb1, d1itzb2, d1itzc1, d1itzc2

Details for d1itzb3

PDB Entry: 1itz (more details), 2.3 Å

PDB Description: Maize Transketolase in complex with TPP
PDB Compounds: (B:) transketolase

SCOP Domain Sequences for d1itzb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itzb3 c.48.1.1 (B:540-675) Transketolase (TK), C-domain {Maize (Zea mays) [TaxId: 4577]}
pgtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvsw
elfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyk
eygitvesiiaaaksf

SCOP Domain Coordinates for d1itzb3:

Click to download the PDB-style file with coordinates for d1itzb3.
(The format of our PDB-style files is described here.)

Timeline for d1itzb3: