Lineage for d1itzb1 (1itz B:10-347)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483377Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 483378Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 483603Family c.36.1.10: TK-like PP module [88760] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 483610Protein Transketolase (TK), PP module [88761] (3 species)
  7. 483629Species Maize (Zea mays) [TaxId:4577] [88763] (1 PDB entry)
  8. 483631Domain d1itzb1: 1itz B:10-347 [76800]
    Other proteins in same PDB: d1itza2, d1itza3, d1itzb2, d1itzb3, d1itzc2, d1itzc3

Details for d1itzb1

PDB Entry: 1itz (more details), 2.3 Å

PDB Description: Maize Transketolase in complex with TPP

SCOP Domain Sequences for d1itzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itzb1 c.36.1.10 (B:10-347) Transketolase (TK), PP module {Maize (Zea mays)}
aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
rhtpegaaleadwnakfaeyekkyaddaatlksiitge

SCOP Domain Coordinates for d1itzb1:

Click to download the PDB-style file with coordinates for d1itzb1.
(The format of our PDB-style files is described here.)

Timeline for d1itzb1: