Lineage for d1itza3 (1itz A:540-675)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 316015Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 316016Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 316017Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 316022Protein Transketolase (TK), C-domain [52924] (3 species)
    two N-terminal domains are PP and Pyr modules of thiamin-binding fold
  7. 316041Species Maize (Zea mays) [TaxId:4577] [82430] (1 PDB entry)
  8. 316042Domain d1itza3: 1itz A:540-675 [76799]
    Other proteins in same PDB: d1itza1, d1itza2, d1itzb1, d1itzb2, d1itzc1, d1itzc2

Details for d1itza3

PDB Entry: 1itz (more details), 2.3 Å

PDB Description: Maize Transketolase in complex with TPP

SCOP Domain Sequences for d1itza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itza3 c.48.1.1 (A:540-675) Transketolase (TK), C-domain {Maize (Zea mays)}
pgtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvsw
elfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyk
eygitvesiiaaaksf

SCOP Domain Coordinates for d1itza3:

Click to download the PDB-style file with coordinates for d1itza3.
(The format of our PDB-style files is described here.)

Timeline for d1itza3: