| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.6: TK-like Pyr module [88735] (2 proteins) different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain |
| Protein Transketolase (TK), Pyr module [88736] (4 species) |
| Species Maize (Zea mays) [TaxId:4577] [88738] (1 PDB entry) |
| Domain d1itza2: 1itz A:348-539 [76798] Other proteins in same PDB: d1itza1, d1itza3, d1itzb1, d1itzb3, d1itzc1, d1itzc3 complexed with mg, tpp |
PDB Entry: 1itz (more details), 2.3 Å
SCOPe Domain Sequences for d1itza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1itza2 c.36.1.6 (A:348-539) Transketolase (TK), Pyr module {Maize (Zea mays) [TaxId: 4577]}
lptgwvdalpkytpespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdf
qkdtaeernvrfgvrehgmgaicngialhspgfvpycatffvftdymrgamrisalseag
viyvmthdsiglgedgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrps
ilalsrqklphl
Timeline for d1itza2: