Lineage for d1itza2 (1itz A:348-539)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242757Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 242758Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
    both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold
    conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules
  5. 242840Family c.36.1.2: TK-like THDP-binding domains [52528] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 242847Protein Transketolase (TK), PP and Pyr modules [52529] (2 species)
  7. 242877Species Maize (Zea mays) [TaxId:4577] [82392] (1 PDB entry)
  8. 242879Domain d1itza2: 1itz A:348-539 [76798]
    Other proteins in same PDB: d1itza3, d1itzb3, d1itzc3

Details for d1itza2

PDB Entry: 1itz (more details), 2.3 Å

PDB Description: Maize Transketolase in complex with TPP

SCOP Domain Sequences for d1itza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1itza2 c.36.1.2 (A:348-539) Transketolase (TK), PP and Pyr modules {Maize (Zea mays)}
lptgwvdalpkytpespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdf
qkdtaeernvrfgvrehgmgaicngialhspgfvpycatffvftdymrgamrisalseag
viyvmthdsiglgedgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrps
ilalsrqklphl

SCOP Domain Coordinates for d1itza2:

Click to download the PDB-style file with coordinates for d1itza2.
(The format of our PDB-style files is described here.)

Timeline for d1itza2: