Lineage for d1it9h1 (1it9 H:1-121)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287642Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1287727Domain d1it9h1: 1it9 H:1-121 [76783]
    Other proteins in same PDB: d1it9h2, d1it9l1, d1it9l2
    part of humanized anti-human Fas Fab HFE7A

Details for d1it9h1

PDB Entry: 1it9 (more details), 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a
PDB Compounds: (H:) humanized antibody hfe7a, heavy chain

SCOPe Domain Sequences for d1it9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1it9h1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlvqsgaevkkpgasvkvsckasgytftsywmqwvkqapgqglewmgeidpsdsytny
nqkfkgkatltvdtststaymelsslrsedtavyycarnrdysnnwyfdvwgegtlvtvs
s

SCOPe Domain Coordinates for d1it9h1:

Click to download the PDB-style file with coordinates for d1it9h1.
(The format of our PDB-style files is described here.)

Timeline for d1it9h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1it9h2