SCOP 1.63: Domain d1it9h1: 1it9 H:1-121

Lineage for d1it9h1 (1it9 H:1-121)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-human Fas Fab HFE7A, (humanized), kappa L chain [81948] (1 PDB entry)

8. Domain d1it9h1: 1it9 H:1-121 [76783]
   Other proteins in same PDB: d1it9h2, d1it9l2

Details for d1it9h1

PDB Entry: 1it9, 2.8 Å

PDB Description: crystal structure of an antigen-binding fragment from a humanized version of the anti-human fas antibody hfe7a

SCOP Domain Sequences for d1it9h1:

Sequence; same for both SEQRES and ATOM records:

>d1it9h1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Anti-human Fas Fab HFE7A, (humanized), kappa L chain}
qvqlvqsgaevkkpgasvkvsckasgytftsywmqwvkqapgqglewmgeidpsdsytny
nqkfkgkatltvdtststaymelsslrsedtavyycarnrdysnnwyfdvwgegtlvtvs
s

Timeline for d1it9h1:

• d1it9h1 is new in SCOP 1.63
  
• d1it9h1 appears in SCOP 1.65
  
• d1it9h1 appears in the current release, SCOPe 2.08