Lineage for d1iqxa2 (1iqx A:9-96)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 254865Fold d.17: Cystatin-like [54402] (5 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 254922Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 254923Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
    duplication: contains two domains of this fold
  6. 254924Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 254925Species Arthrobacter globiformis [TaxId:1665] [54421] (10 PDB entries)
  8. 254942Domain d1iqxa2: 1iqx A:9-96 [76758]
    Other proteins in same PDB: d1iqxa1, d1iqxb1

Details for d1iqxa2

PDB Entry: 1iqx (more details), 2 Å

PDB Description: crystal structure of cobalt-substituted amine oxidase from arthrobacter globiformis

SCOP Domain Sequences for d1iqxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqxa2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOP Domain Coordinates for d1iqxa2:

Click to download the PDB-style file with coordinates for d1iqxa2.
(The format of our PDB-style files is described here.)

Timeline for d1iqxa2: