Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) |
Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Arthrobacter globiformis [TaxId:1665] [54421] (10 PDB entries) |
Domain d1iqxa2: 1iqx A:9-96 [76758] Other proteins in same PDB: d1iqxa1, d1iqxb1 |
PDB Entry: 1iqx (more details), 2 Å
SCOP Domain Sequences for d1iqxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqxa2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis} aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs garpqevtvsvtngtvisaveldtaatg
Timeline for d1iqxa2: