Lineage for d1ioca_ (1ioc A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 323347Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tussues ans secretions
  7. 323554Species Human (Homo sapiens) [TaxId:9606] [53969] (202 PDB entries)
  8. 323777Domain d1ioca_: 1ioc A: [76754]
    complexed with na; mutant

Details for d1ioca_

PDB Entry: 1ioc (more details), 2.4 Å

PDB Description: crystal structure of mutant human lysozyme, eaea-i56t

SCOP Domain Sequences for d1ioca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioca_ d.2.1.2 (A:) Lysozyme {Human (Homo sapiens)}
aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtf
qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
nrdvrqyvqgcgv

SCOP Domain Coordinates for d1ioca_:

Click to download the PDB-style file with coordinates for d1ioca_.
(The format of our PDB-style files is described here.)

Timeline for d1ioca_: