SCOPe 2.06: Domain d1io0a_: 1io0 A:

Lineage for d1io0a_ (1io0 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.1: RNI-like [52047] (4 families)
   regular structure consisting of similar repeats

5. Family c.10.1.1: 28-residue LRR [52048] (3 proteins)
   this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain

6. Protein Tropomodulin C-terminal domain [82322] (2 species)
   duplication: consists of 5 repeats

7. Species Chicken (Gallus gallus) [TaxId:9031] [82323] (1 PDB entry)

8. Domain d1io0a_: 1io0 A: [76753]
   complexed with zn

Details for d1io0a_

PDB Entry: 1io0, 1.45 Å

PDB Description: crystal structure of tropomodulin c-terminal half

PDB Compounds: (A:) tropomodulin

SCOPe Domain Sequences for d1io0a_:

Sequence; same for both SEQRES and ATOM records:

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
nstdveetlkriqnndpdleevnlnnimnipvptlkacaealktntyvkkfsivgtrsnd
pvafalaemlkvnntlkslnvesnfisgsgilalvealqsntslielridnqsqplgnnv
emeianmleknttllkfgyhftqqgprlrasnammnnndlvrkrrl

Timeline for d1io0a_:

• d1io0a_ first appeared in SCOP 1.63
  
• d1io0a_ appears in SCOPe 2.05
  
• d1io0a_ appears in SCOPe 2.07
  
• d1io0a_ appears in the current release, SCOPe 2.08