Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (4 families) regular structure consisting of similar repeats |
Family c.10.1.1: 28-residue LRR [52048] (3 proteins) this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain |
Protein Tropomodulin C-terminal domain [82322] (2 species) duplication: consists of 5 repeats |
Species Chicken (Gallus gallus) [TaxId:9031] [82323] (1 PDB entry) |
Domain d1io0a_: 1io0 A: [76753] complexed with zn |
PDB Entry: 1io0 (more details), 1.45 Å
SCOPe Domain Sequences for d1io0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} nstdveetlkriqnndpdleevnlnnimnipvptlkacaealktntyvkkfsivgtrsnd pvafalaemlkvnntlkslnvesnfisgsgilalvealqsntslielridnqsqplgnnv emeianmleknttllkfgyhftqqgprlrasnammnnndlvrkrrl
Timeline for d1io0a_: