Lineage for d1ij5a_ (1ij5 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 641370Family a.39.1.9: Cbp40 (plasmodial specific CaII-binding protein LAV1-2) [81758] (1 protein)
    4 EF-hands assembled in a compact structure like the Penta-EF-hand proteins; contains additional N-terminal all-alpha subdomain
  6. 641371Protein Cbp40 (plasmodial specific CaII-binding protein LAV1-2) [81759] (1 species)
  7. 641372Species Slime mold (Physarum polycephalum) [TaxId:5791] [81760] (2 PDB entries)
  8. 641373Domain d1ij5a_: 1ij5 A: [76748]
    Ca-free structure

Details for d1ij5a_

PDB Entry: 1ij5 (more details), 3 Å

PDB Description: metal-free structure of multidomain ef-hand protein, cbp40, from true slime mold
PDB Compounds: (A:) plasmodial specific lav1-2 protein

SCOP Domain Sequences for d1ij5a_:

Sequence, based on SEQRES records: (download)

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Slime mold (Physarum polycephalum) [TaxId: 5791]}
eifsqeltqreanvkkvhenleelqkkldhtsfahkedrdrleaqiaqkeqeqkaklaey
dqkvqnefdareraerereaargdaaaekqrlasllkdleddasgynrlrpskpmlseed
tnilrqlflssavsgsgkfsfqdlkqvlakyadtipegplkklfvmvendtkgrmsyitl
vavandlaalvadfrkidtnsngtlsrkefrehfvrlgfdkksvqdalfryadedesddv
gfseyvhlglcllvlrilyafadfdksgqlskeevqkvledahipesarkkfehqfsvvd
vddskslsyqefvmlvllmfh

Sequence, based on observed residues (ATOM records): (download)

>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Slime mold (Physarum polycephalum) [TaxId: 5791]}
eifsqeltqreanvkkvhenleelqkkldhtsfahdrleaqiaqkeqeqkaklaeydqkv
qnefdareraerereaargdaaaekqrlasllkdlekpmlseedtnilrqlflssavsgs
gkfsfqdlkqvlakyadtipegplkklfvmvendtkgrmsyitlvavandlaalvadfrk
idtnsngtlsrkefrehfvrlgfdkksvqdalfryadedesddvgfseyvhlglcllvlr
ilyafadfdksgqlskeevqkvledahipesarkkfehqfsvvdvddskslsyqefvmlv
llmfh

SCOP Domain Coordinates for d1ij5a_:

Click to download the PDB-style file with coordinates for d1ij5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ij5a_: