SCOP 1.69: Domain d1ic8b2: 1ic8 B:85-179

Lineage for d1ic8b2 (1ic8 B:85-179)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families)

5. Family a.35.1.1: POU-specific domain [47414] (3 proteins)

6. Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [81748] (1 species)
   atypical POU domain with extra N-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [81749] (1 PDB entry)

8. Domain d1ic8b2: 1ic8 B:85-179 [76743]
   Other proteins in same PDB: d1ic8a1, d1ic8b1

Details for d1ic8b2

PDB Entry: 1ic8, 2.6 Å

PDB Description: hepatocyte nuclear factor 1a bound to dna : mody3 gene product

SCOP Domain Sequences for d1ic8b2:

Sequence; same for both SEQRES and ATOM records:

>d1ic8b2 a.35.1.1 (B:85-179) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens)}
ilkelenlspeeaahqkavvetllqedpwrvakmvksylqqhnipqrevvdttglnqshl
sqhlnkgtpmktqkraalytwyvrkqrevaqqfth

Timeline for d1ic8b2:

• d1ic8b2 first appeared in SCOP 1.63
  
• d1ic8b2 appears in SCOP 1.67
  
• d1ic8b2 appears in SCOP 1.71
  
• d1ic8b2 appears in the current release, SCOPe 2.08