Class a: All alpha proteins [46456] (218 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (6 families) |
Family a.35.1.1: POU-specific domain [47414] (3 proteins) |
Protein Hepatocyte nuclear factor 1a (LFB1/HNF1) [81748] (1 species) atypical POU domain with extra N-terminal helix |
Species Human (Homo sapiens) [TaxId:9606] [81749] (1 PDB entry) |
Domain d1ic8b2: 1ic8 B:85-179 [76743] Other proteins in same PDB: d1ic8a1, d1ic8b1 |
PDB Entry: 1ic8 (more details), 2.6 Å
SCOP Domain Sequences for d1ic8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic8b2 a.35.1.1 (B:85-179) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Human (Homo sapiens)} ilkelenlspeeaahqkavvetllqedpwrvakmvksylqqhnipqrevvdttglnqshl sqhlnkgtpmktqkraalytwyvrkqrevaqqfth
Timeline for d1ic8b2: