SCOPe 2.05: Domain d1i4ja_: 1i4j A:

Lineage for d1i4ja_ (1i4j A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (5 species)

7. Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (2 PDB entries)

8. Domain d1i4ja_: 1i4j A: [76734]
   mutant

Details for d1i4ja_

PDB Entry: 1i4j, 1.8 Å

PDB Description: crystal structure of l22 ribosomal protein mutant

PDB Compounds: (A:) 50S ribosomal protein L22

SCOPe Domain Sequences for d1i4ja_:

Sequence; same for both SEQRES and ATOM records:

>d1i4ja_ d.55.1.1 (A:) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]}
meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
nhdaledrlyvkaayvdegpavlprargradiikkrtshitvilgekhgk

Timeline for d1i4ja_:

• d1i4ja_ first appeared in SCOP 1.63
  
• d1i4ja_ appears in SCOPe 2.04
  
• d1i4ja_ appears in SCOPe 2.06
  
• d1i4ja_ appears in the current release, SCOPe 2.08