Lineage for d1hu0a2 (1hu0 A:12-135)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581739Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2581851Family d.129.1.2: DNA repair glycosylase, N-terminal domain [55952] (3 proteins)
    contains a single copy of this fold
  6. 2581892Protein 8-oxoguanine glycosylase [55955] (1 species)
  7. 2581893Species Human (Homo sapiens) [TaxId:9606] [55956] (24 PDB entries)
  8. 2581900Domain d1hu0a2: 1hu0 A:12-135 [76724]
    Other proteins in same PDB: d1hu0a1, d1hu0a3
    borohydride trapped intermediate complex
    protein/DNA complex; complexed with ca, oxg

Details for d1hu0a2

PDB Entry: 1hu0 (more details), 2.35 Å

PDB Description: crystal structure of an hogg1-dna borohydride trapped intermediate complex
PDB Compounds: (A:) 8-oxoguanine DNA glycosylase 1

SCOPe Domain Sequences for d1hu0a2:

Sequence, based on SEQRES records: (download)

>d1hu0a2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
llrq

Sequence, based on observed residues (ATOM records): (download)

>d1hu0a2 d.129.1.2 (A:12-135) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]}
ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
qlhctvyrsqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvrllr
q

SCOPe Domain Coordinates for d1hu0a2:

Click to download the PDB-style file with coordinates for d1hu0a2.
(The format of our PDB-style files is described here.)

Timeline for d1hu0a2: