Lineage for d1hfbf_ (1hfb F:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 237126Superfamily c.1.10: Aldolase [51569] (4 families) (S)
    Common fold covers whole protein structure
  5. 237342Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 237343Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (2 species)
  7. 237361Species Saccharomyces cerevisiae, tyrosine-regulated isozyme [TaxId:4932] [82272] (1 PDB entry)
  8. 237367Domain d1hfbf_: 1hfb F: [76711]

Details for d1hfbf_

PDB Entry: 1hfb (more details), 1.9 Å

PDB Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phosphoenolpyruvate

SCOP Domain Sequences for d1hfbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfbf_ c.1.10.4 (F:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Saccharomyces cerevisiae, tyrosine-regulated isozyme}
vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
nqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevn

SCOP Domain Coordinates for d1hfbf_:

Click to download the PDB-style file with coordinates for d1hfbf_.
(The format of our PDB-style files is described here.)

Timeline for d1hfbf_: