Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId:4932] [82272] (11 PDB entries) |
Domain d1hfbc_: 1hfb C: [76708] complexed with pep |
PDB Entry: 1hfb (more details), 1.9 Å
SCOPe Domain Sequences for d1hfbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfbc_ c.1.10.4 (C:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]} vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg nqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk
Timeline for d1hfbc_: