Lineage for d1hfbc_ (1hfb C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835534Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2835535Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (3 species)
  7. 2835536Species Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId:4932] [82272] (11 PDB entries)
  8. 2835549Domain d1hfbc_: 1hfb C: [76708]
    complexed with pep

Details for d1hfbc_

PDB Entry: 1hfb (more details), 1.9 Å

PDB Description: crystal structure of the tyrosine-regulated 3-deoxy-d-arabino- heptulosonate-7-phosphate synthase from saccharomyces cerevisiae complexed with phosphoenolpyruvate
PDB Compounds: (C:) tyrosine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase

SCOPe Domain Sequences for d1hfbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfbc_ c.1.10.4 (C:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Baker's yeast (Saccharomyces cerevisiae), tyrosine-regulated isozyme [TaxId: 4932]}
vrilgydplaspallqvqipatptsletakrgrreaidiitgkddrvlvivgpcsihdle
aaqeyalrlkklsdelkgdlsiimraylekprttvgwkglindpdvnntfninkglqsar
qlfvnltniglpigsemldtispqyladlvsfgaigarttesqlhrelasglsfpvgfkn
gtdgtlnvavdacqaaahshhfmgvtkhgvaaitttkgnehcfvilrggkkgtnydaksv
aeakaqlpagsnglmidyshgnsnkdfrnqpkvndvvceqiangenaitgvmiesnineg
nqgipaegkaglkygvsitdacigwettedvlrklaaavrqrrevnkk

SCOPe Domain Coordinates for d1hfbc_:

Click to download the PDB-style file with coordinates for d1hfbc_.
(The format of our PDB-style files is described here.)

Timeline for d1hfbc_: