![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
![]() | Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
![]() | Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
![]() | Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (2 PDB entries) psychrophilic alkaline protease |
![]() | Domain d1h71p2: 1h71 P:3-244 [76705] Other proteins in same PDB: d1h71p1 complexed with ca, zn |
PDB Entry: 1h71 (more details), 2.1 Å
SCOP Domain Sequences for d1h71p2:
Sequence, based on SEQRES records: (download)
>d1h71p2 d.92.1.6 (P:3-244) Metalloprotease {Pseudomonas sp., tac ii 18} gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghqtfanf sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl yg
>d1h71p2 d.92.1.6 (P:3-244) Metalloprotease {Pseudomonas sp., tac ii 18} gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghqtfanf sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd ynptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg
Timeline for d1h71p2: