| Class b: All beta proteins [48724] (178 folds) |
| Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.7: beta-Roll [51120] (2 families) ![]() superhelix turns are made of two short strands each |
| Family b.80.7.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) duplication: halfturs of beta-helix are sequence and structural repeats; binds calcium ions between the turns this is a repeat family; one repeat unit is 1go7 P:374-356 found in domain |
| Protein Metalloprotease [51122] (4 species) The catalytic N-terminal domain belong to the "zincin" superfamily |
| Species Pseudomonas sp., tac ii 18 [TaxId:306] [82190] (8 PDB entries) psychrophilic alkaline protease |
| Domain d1h71p1: 1h71 P:245-463 [76704] Other proteins in same PDB: d1h71p2 complexed with ca, zn |
PDB Entry: 1h71 (more details), 2.1 Å
SCOPe Domain Sequences for d1h71p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h71p1 b.80.7.1 (P:245-463) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
anletraddtvygfnstadrdfysatsstdklifsvwdgggndtldfsgfsqnqkinlta
gsfsdvggmtgnvsiaqgvtienaiggsgndlligndaanvlkggagndiiyggggadvl
wggtgsdtfvfgavsdstpkaadiikdfqsgfdkidltaitklgglnfvdaftghagdai
vsyhqasnagslqvdfsgqgvadflvttvgqvatydiva
Timeline for d1h71p1: