Lineage for d1h40a_ (1h40 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286844Fold a.159: Another 3-helical bundle [81602] (2 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 286850Superfamily a.159.2: FF domain [81698] (1 family) (S)
  5. 286851Family a.159.2.1: FF domain [81699] (1 protein)
  6. 286852Protein Hypa/FBP11 [81700] (1 species)
  7. 286853Species Human (Homo sapiens) [TaxId:9606] [81701] (1 PDB entry)
  8. 286854Domain d1h40a_: 1h40 A: [76671]
    CASP5

Details for d1h40a_

PDB Entry: 1h40 (more details)

PDB Description: the structure of an ff domain from human hypa/fbp11

SCOP Domain Sequences for d1h40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h40a_ a.159.2.1 (A:) Hypa/FBP11 {Human (Homo sapiens)}
qpakktytwntkeeakqafkellkekrvpsnasweqamkmiindprysalaklsekkqaf
naykvqtek

SCOP Domain Coordinates for d1h40a_:

Click to download the PDB-style file with coordinates for d1h40a_.
(The format of our PDB-style files is described here.)

Timeline for d1h40a_: