Lineage for d1h3yb2 (1h3y B:342-443)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289555Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 289558Species Human (Homo sapiens) [TaxId:9606] [88590] (19 PDB entries)
  8. 289589Domain d1h3yb2: 1h3y B:342-443 [76670]
    Other proteins in same PDB: d1h3ya1, d1h3yb1
    part of a Fc
    complexed with afl, bma, gla, man, nag, ndg

Details for d1h3yb2

PDB Entry: 1h3y (more details), 4.1 Å

PDB Description: crystal structure of a human igg1 fc-fragment,high salt condition

SCOP Domain Sequences for d1h3yb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3yb2 b.1.1.2 (B:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOP Domain Coordinates for d1h3yb2:

Click to download the PDB-style file with coordinates for d1h3yb2.
(The format of our PDB-style files is described here.)

Timeline for d1h3yb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3yb1