Lineage for d1h3yb1 (1h3y B:238-341)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453802Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 453803Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries)
  8. 453840Domain d1h3yb1: 1h3y B:238-341 [76669]
    Other proteins in same PDB: d1h3ya2, d1h3yb2
    part of a Fc

Details for d1h3yb1

PDB Entry: 1h3y (more details), 4.1 Å

PDB Description: crystal structure of a human igg1 fc-fragment,high salt condition

SCOP Domain Sequences for d1h3yb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3yb1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOP Domain Coordinates for d1h3yb1:

Click to download the PDB-style file with coordinates for d1h3yb1.
(The format of our PDB-style files is described here.)

Timeline for d1h3yb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3yb2