![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries) |
![]() | Domain d1h3yb1: 1h3y B:238-341 [76669] Other proteins in same PDB: d1h3ya2, d1h3yb2 part of a Fc |
PDB Entry: 1h3y (more details), 4.1 Å
SCOP Domain Sequences for d1h3yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3yb1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)} psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg
Timeline for d1h3yb1: