SCOP 1.65: Domain d1h3yb1: 1h3y B:238-341

Lineage for d1h3yb1 (1h3y B:238-341)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (19 PDB entries)

8. Domain d1h3yb1: 1h3y B:238-341 [76669]
   Other proteins in same PDB: d1h3ya2, d1h3yb2
   part of a Fc
   complexed with afl, bma, gla, man, nag, ndg

Details for d1h3yb1

PDB Entry: 1h3y, 4.1 Å

PDB Description: crystal structure of a human igg1 fc-fragment,high salt condition

SCOP Domain Sequences for d1h3yb1:

Sequence; same for both SEQRES and ATOM records:

>d1h3yb1 b.1.1.2 (B:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1h3yb1:

• d1h3yb1 first appeared in SCOP 1.63
  
• d1h3yb1 appears in SCOP 1.67
  
• d1h3yb1 appears in the current release, SCOPe 2.08