![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
![]() | Species Fc (human) IgG1 class [49120] (14 PDB entries) |
![]() | Domain d1h3ya2: 1h3y A:342-443 [76668] |
PDB Entry: 1h3y (more details), 4.1 Å
SCOP Domain Sequences for d1h3ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ya2 b.1.1.2 (A:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class} qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
Timeline for d1h3ya2: