Lineage for d1h3wm2 (1h3w M:342-443)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.1: Immunoglobulin [48726] (4 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) 
Species Fc (human) IgG1 class [49120] (14 PDB entries) 
Domain d1h3wm2: 1h3w M:342-443 [76666]
complexed with bma, fuc, nag
Details for d1h3wm2
PDB Entry: 1h3w (more details), 2.85 Å
PDB Description: structural analysis of human igg-fc glycoforms reveals a correlation between glycosylation and structural integrity
SCOP Domain Sequences for d1h3wm2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3wm2 b.1.1.2 (M:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class}
qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl
SCOP Domain Coordinates for d1h3wm2:
Click to download the PDB-style file with coordinates for d1h3wm2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1h3wm2:
- d1h3wm2 is new in SCOP 1.63
- d1h3wm2 appears in SCOP 1.65
- d1h3wm2 appears in the current release, SCOPe 2.08
View in 3D
