SCOP 1.71: Domain d1h3wm1: 1h3w M:238-341

Lineage for d1h3wm1 (1h3w M:238-341)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88585] (22 PDB entries)

8. Domain d1h3wm1: 1h3w M:238-341 [76665]
   Other proteins in same PDB: d1h3wm2
   part of a Fc
   complexed with bma, fuc, nag

Details for d1h3wm1

PDB Entry: 1h3w, 2.85 Å

PDB Description: structural analysis of human igg-fc glycoforms reveals a correlation between glycosylation and structural integrity

SCOP Domain Sequences for d1h3wm1:

Sequence; same for both SEQRES and ATOM records:

>d1h3wm1 b.1.1.2 (M:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens)}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

Timeline for d1h3wm1:

• d1h3wm1 first appeared in SCOP 1.63
  
• d1h3wm1 appears in SCOP 1.69
  
• d1h3wm1 appears in SCOP 1.73
  
• d1h3wm1 appears in the current release, SCOPe 2.08