Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88590] (19 PDB entries) |
Domain d1h3vb2: 1h3v B:342-444 [76664] Other proteins in same PDB: d1h3va1, d1h3vb1 part of a Fc complexed with afl, bma, gal, nag |
PDB Entry: 1h3v (more details), 3.1 Å
SCOP Domain Sequences for d1h3vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3vb2 b.1.1.2 (B:342-444) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens)} qprepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls
Timeline for d1h3vb2: